PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.X4GVE
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family Nin-like
Protein Properties Length: 199aa    MW: 23612 Da    PI: 5.0787
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.X4GVEgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK78.38.7e-2590140252
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  ++e++ ++++k+F+lpi++AA++++++lT+LKr+CR++ IkRWPhRkiksl
  Araip.X4GVE  90 KSELEYDEIKKHFDLPITEAASKMNIGLTLLKRRCRELSIKRWPHRKIKSL 140
                  67899********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.84781162IPR003035RWP-RK domain
PfamPF020423.8E-2193140IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MEFFNNELDS FSNDIDKIME ISPMDDFDDW APLLTYKSTQ KLFLNDLPEV DNDFDDLPPL  60
DDFKKEREEE DQEHKQLLQL APISTIKNKK SELEYDEIKK HFDLPITEAA SKMNIGLTLL  120
KRRCRELSIK RWPHRKIKSL HLLIQTLKEI GLDNEVEMLE QEINMLKQVP GTEITQETKK  180
LRQAYFKANY KRRKLLASN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016163312.11e-129PREDICTED: protein RKD4
SwissprotQ9LVU82e-36RKD4_ARATH; Protein RKD4
TrEMBLG7J7G03e-52G7J7G0_MEDTR; RWP-RK domain protein
STRINGGLYMA04G41320.22e-49(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.11e-37RWP-RK domain-containing protein